PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 339aa    MW: 37780.3 Da    PI: 6.1023
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687072PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-22634PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431e-1370112246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+el+++++   G++ W  Ia+ ++ gRt++++k++w++
        Lsa002902  70 QSFTQQEEELIIKLHSAIGSR-WPIIAQQLP-GRTDNDVKNYWNT 112
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.655962IPR017877Myb-like domain
SuperFamilySSF466897.65E-1711110IPR009057Homeodomain-like
SMARTSM007171.51364IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-71573IPR009057Homeodomain-like
PROSITE profilePS5129420.88264118IPR017930Myb domain
SMARTSM007171.5E-1268116IPR001005SANT/Myb domain
PfamPF002492.5E-1270112IPR001005SANT/Myb domain
CDDcd001671.44E-971114No hitNo description
Gene3DG3DSA:1.10.10.609.9E-2074118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MVRPPCCDKL SMRKGSWNEE DDAQMLAFVS KQPTTNWQAG APKKPGLRKC GKSCRLRKTN  60
VATNDHIRHQ SFTQQEEELI IKLHSAIGSR WPIIAQQLPG RTDNDVKNYW NTKLKKKLSA  120
MGIDPVTHRP FSQMLADYGS ISGLTRNQTR MGSLNRDNNN NNNTFFITNQ ENHVFQQSPT  180
ESFFPNFNNS NNVKMEPPEV VIKSDSLDLL TQLQAITHVK DSSTNHGIGI SLTQFHVSVA  240
SSSSSSSSTC STLNEMTTPQ QTFNWRDFLI ENGQDGDEKL NLEAMGGVEV VKCNTPLLMN  300
GVKESIEEGC DGSFVEAMLD GSENDMLLDF PGLLGEPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-20141187108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448456.16e-91PREDICTED: transcription factor MYB86
RefseqXP_012448457.16e-91PREDICTED: transcription factor MYB86
RefseqXP_012448458.16e-91PREDICTED: transcription factor MYB86
TrEMBLA0A0D2UC287e-91A0A0D2UC28_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.19e-55MYB family protein